Server:Apache...
The main IP address: 185.119.173.38,Your server -,- ISP:- TLD:uk CountryCode:-
The description :bw3 web design newcastle - professional and affordable web design and website development. an experienced wordpress web designer and digital imaging expert, bw3 specialises in small business websites ...
This report updates in 11-Jun-2018
Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host bw3.co.uk. Currently, hosted in - and its service provider is - .
Latitude: | 0 |
Longitude: | 0 |
Country: | - (-) |
City: | - |
Region: | - |
ISP: | - |
HTTP Header information is a part of HTTP protocol that a user's browser sends to called Apache containing the details of what the browser wants and will accept back from the web server.
Content-Length: | 12253 |
Content-Encoding: | gzip |
Set-Cookie: | DYNSRV=lin-10-170-0-121; path=/ |
Vary: | Accept-Encoding |
Server: | Apache |
Connection: | close |
Link: | |
Date: | Mon, 11 Jun 2018 00:32:25 GMT |
Content-Type: | text/html; charset=UTF-8 |
soa: | ns1.vidacloud.co.uk. support.vidacloud.co.uk. 1455184938 10800 3600 604800 3600 |
txt: | "v=spf1 a mx include:gridhost.co.uk ip4:95.142.156.0/24 ip4:195.62.28.0/23 ~all" |
ns: | ns1.vidacloud.co.uk. ns2.vidacloud.co.uk. |
ipv4: | IP:185.119.173.38 ASN:198047 OWNER:UKWEB-EQX, GB Country:GB |
mx: | MX preference = 0, mail exchanger = mail3.eqx.gridhost.co.uk. |
0793 0982 007 [email protected] facebook twitter facebook twitter about our services testimonials portfolio packages contact select page bw3 - web design newcastle an experienced website designer who cares, understands and builds relationships to create great wordpress sites which represent you and your business. get in touch small business specialist our affordable small business packages take the pain out of developing your website, letting you get on with what you’re good at – running your business. portfolio bespoke design a designer and photographer as well as being a dab hand at html and css, we can help develop your brand both offline and online. what we do brochure & ecommerce sites if you have a product or service to sell or promote online then we can help. bw3 has a vast experience of bringing businesses to life online, whatever the subject. testimonials web design newcastle welcome to bw3 bw3 is an independent, web design company based in newcastle upon tyne. the company specialises in creating professional wordpress sites and everything that goes with giving your company an online window to your customers. no fuss, no ridiculous prices, just websites that communicate with clear, strong messages. whether you’re looking for a simple one page brochure website or a full ecommerce solution to take your sales online, we pride ourselves on offering our clients affordable, high quality website design that will perform for you and deliver your business objectives. we have completed a large number of projects ranging from local sole traders, small start-ups, through to collaborating on brand promotions for major businesses such as the bbc, o2 and shell uk. our business start-up packages are affordable and stress-free. our services not only websites, a whole lot more… we believe that the key to good design is to strip away the unnecessary to produce a clean, clear message… your message. through print design, web design, and business branding, we deliver your message to the people you need to reach, to help your business thrive. drop us a line no. 1 great web design for responsive websites good web design is at the heart of everything bw3 does. clear, expertly created, responsive sites all built on the powerful wordpress platform and cms to give you overall control. no. 2 photography and image editing from chocolate bars to housing estates, taxi cabs to charging points, we do photo shoots for client products and services. as photoshop users for over 25 years, we are also experts in i mage manipulation, photo re-touching and digital developing. no. 3 print design as a skilled graphic designer, bw3 can also support your offline marketing to ensure a consistent look and message across all channels including logo design, business cards, flyers and brochures. no. 4 digital marketing from making sure your business ranks on search engines to helping with e-marketing and social media, we can help ensure that your website gets in front of potential customers. no. 5 ongoing development a website needs to grow and we’re in this for the long haul. we can help you to understand the analytics behind your website, what’s driving traffic to your site, what your customers are doing to help steer your website in the right direction. no. 6 hosting your website needs a home and we offer secure web hosting with our hosting agent. high performance and reliability are guaranteed and we’re always here to offer support. our work portfolio & case studies we’ve been in the business of web design since 1999, working with both household names alongside small start-up businesses. today, bw3 mainly specialises in working with new and small businesses, both in the north east and throughout the uk, often with their first business websites. it’s what we enjoy most – helping people who are passionate about their ideas and making sure that they have a strong start online. we’re proud of the diversity of our clients and the thing that remains consistent is our drive to create first-class websites. from technology companies to taxi firms, rubber bands to local bands, we’ve applied our expertise to a range of sectors. take a look at just some of the companies that we have worked with recently and if you’re interested in finding out more, we’d love to hear from you. velo cycling direct 3rd may 2018 noda taxis 3rd april 2018 zero carbon futures 3rd april 2018 mojo lingerie 3rd march 2018 north chocolates 3rd february 2018 flyer & poster design 3rd february 2017 premier chimney sweep 3rd january 2017 logo design 3rd april 2016 testimonials what people are saying “it’s a minor miracle…” “paul not only set up my website but made it simple enough so i could adapt and update it myself – not only a huge saving in terms of cost and time but (for me) also a minor miracle. he listened to me as a client, didn’t charge stupid money, made suggestions which i would never have thought of and is always quick to respond if i’ve a problem; within 3 months my site had paid for itself.” bev stephenson north chocolates “perfectly suited my needs” “i’m really happy to recommend paul and bw3. he produced a website that perfectly suited my needs with the minimum of fuss and at an excellent price, and it looks really good as well! i have absolutely no technical or design background but paul is very easy to talk to and he quickly appreciated what i wanted from my site, which made the whole design process a very smooth one.” simon powell premier chimney sweeping “pleasure to work with” “working with paul to create our company’s website couldn’t have been simpler. he’s easy to talk to, kept in touch through the whole process providing updates and feedback, and was a genuine pleasure to work with – beats all other companies we tried hands down. the final product looks professional & bespoke and we are proud to have it as our website. amazing service, we have already recommended you to others.” apex seminars & events got questions? need answers? it's good to talk, it's also free, so... get in touch web design web design newcastle web development and design small business websites wordpress specialist mobile-friendly design ecommerce sites digital marketing hosting print services design service for all your business print needs business card design letterheads, comp slips logo design flyer design leaflet design and print newspaper ads, magazine ads contact bw3 bw3 webdesign 9 hotspur st heaton newcastle upon tyne ne6 5be +44 (0)793 0982 007 [email protected] photo services client photography & portfolio website illustrations, and product shots for your brochures or ad banners about our services testimonials portfolio packages contact facebook twitter designed by bw3 | copyright © 2018 bw3 | privacy policy
https://bw3.co.uk/project/premier-chimney-sweep/
https://bw3.co.uk/portfolio/
https://bw3.co.uk/project/logo-design/
https://bw3.co.uk/small-business-websites-packages/
https://bw3.co.uk/
https://bw3.co.uk/#our-services
https://bw3.co.uk/mailto:[email protected]
https://bw3.co.uk/project/noda-taxis/
https/www.bw3.co.uk
https://bw3.co.uk/#contact
https://bw3.co.uk/portfolio-of-small-business-websites-branding-design/
https://bw3.co.uk/project/zero-carbon-futures/
https://bw3.co.uk/project/flyer-poster-design/
https://bw3.co.uk/project/mojo/
https://bw3.co.uk/project/velo-cycling-direct/
writershq.co.uk
premierchimneysweepingservices.co.uk
apexseminars.co.uk
northchocolates.co.uk
Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;
Error for "bw3.co.uk".
the WHOIS query quota for 2600:3c03:0000:0000:f03c:91ff:feae:779d has been exceeded
and will be replenished in 30 seconds
WHOIS lookup made at 11:36:57 20-Aug-2017
--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:
Copyright Nominet UK 1996 - 2017.
You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.
REFERRER http://www.nominet.org.uk
REGISTRAR Nominet UK
SERVERS
SERVER co.uk.whois-servers.net
ARGS bw3.co.uk
PORT 43
TYPE domain
DISCLAIMER
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:
Copyright Nominet UK 1996 - 2017.
You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.
REGISTERED no
DOMAIN
NAME bw3.co.uk
NSERVER
NS1.VIDACLOUD.CO.UK 185.52.27.27
NS2.VIDACLOUD.CO.UK 95.142.155.4
The following list shows you to spelling mistakes possible of the internet users for the website searched .